ENT2 (SLC29A2) Rabbit Polyclonal Antibody

CAT#: TA334056

Rabbit Polyclonal Anti-SLC29A2 Antibody

Product Images

WB Suggested Antibody Titration: 2.5 ug/ml; Positive Control: HepG2

• 

  Human kidney

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-SLC29A2 Antibody: synthetic peptide directed towards the N terminal of human SLC29A2. Synthetic peptide located within the following region: ARILSTNHTGPEDAFNFNNWVTLLSQLPLLLFTLLNSFLYQCVPETVRIL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 50 kDa
• Gene Name: solute carrier family 29 member 2
• Database Link:
  NP_001523
  Entrez Gene 3177 Human
  UniProt ID Q14542
• Background: SLC29A2 mediates equilibrative transport of purine, pyrimidine nucleosides and the purine base hypoxanthine. It is less sensitive than SLC29A1 to inhibition by nitrobenzylthioinosine (NBMPR), dipyridamole, dilazep and draflazine.
• Synonyms: DER12; ENT2; HNP36
• Note: Immunogen sequence homology: Human: 100%; Rabbit: 91%

Reference Data

• Protein Families: Transmembrane