ENT2 (SLC29A2) Rabbit Polyclonal Antibody

SKU TA334056

Rabbit Polyclonal Anti-SLC29A2 Antibody

Product Data

• Application: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-SLC29A2 Antibody: synthetic peptide directed towards the N terminal of human SLC29A2. Synthetic peptide located within the following region: ARILSTNHTGPEDAFNFNNWVTLLSQLPLLLFTLLNSFLYQCVPETVRIL
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 50 kDa
• Gene Name: solute carrier family 29 member 2
• Database Link:
  NP_001523
  Q14542
• Background: SLC29A2 mediates equilibrative transport of purine, pyrimidine nucleosides and the purine base hypoxanthine. It is less sensitive than SLC29A1 to inhibition by nitrobenzylthioinosine (NBMPR), dipyridamole, dilazep and draflazine.
• Synonyms: DER12; ENT2; HNP36
• Note: Immunogen sequence homology: Human: 100%; Rabbit: 91%

Reference Data

• Protein Families: Transmembrane