Solute carrier family 22 member 18 (SLC22A18) Rabbit Polyclonal Antibody

SKU TA334053

Rabbit Polyclonal Anti-SLC22A18 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-SLC22A18 Antibody: synthetic peptide directed towards the N terminal of human SLC22A18. Synthetic peptide located within the following region: AASSPALPGVYLLFASRLPGALMHTLPAAQMVITDLSAPEERPAALGRLG
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 45 kDa
• Gene Name: solute carrier family 22 member 18
• Database Link:
  NP_002546
  Q96BI1
• Background: This gene is one of several tumor-suppressing subtransferable fragments located in the imprinted gene domain of 11p15.5, an important tumor-suppressor gene region. Alterations in this region have been associated with the Beckwith-Wiedemann syndrome, Wilms tumor, rhabdomyosarcoma, adrenocortical carcinoma, and lung, ovarian, and breast cancer. This gene may play a role in malignancies and disease that involve this region as well as the transport of chloroquine- and quinidine-related compounds in the kidney.This gene is one of several tumor-suppressing subtransferable fragments located in the imprinted gene domain of 11p15.5, an important tumor-suppressor gene region. Alterations in this region have been associated with the Beckwith-Wiedemann syndrome, Wilms tumor, rhabdomyosarcoma, adrenocortical carcinoma, and lung, ovarian, and breast cancer. This gene may play a role in malignancies and disease that involve this region as well as the transport of chloroquine- and quinidine-related compounds in the kidney. Two alternative transcripts encoding the same isoform have been described.
• Synonyms: BWR1A; BWSCR1A; HET; IMPT1; ITM; ORCTL2; p45-BWR1A; SLC22A1L; TSSC5
• Note: Immunogen sequence homology: Human: 100%; Pig: 93%; Horse: 93%; Guinea pig: 93%; Mouse: 86%; Bovine: 86%; Rat: 79%

Reference Data

• Protein Families: Druggable Genome, Transmembrane