CAT1 (SLC7A1) Rabbit Polyclonal Antibody
USD 436.00
USD 200.00
USD 867.00
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-SLC7A1 Antibody: synthetic peptide directed towards the N terminal of human SLC7A1. Synthetic peptide located within the following region: ELWAFITGWNLILSYIIGTSSVARAWSATFDELIGRPIGEFSRTHMTLNA |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 68 kDa |
Gene Name | solute carrier family 7 member 1 |
Database Link | |
Background | SLC7A1 is a high-affinity, low capacity permease involved in the transport of the cationic amino acids (arginine, lysine and ornithine) in non-hepatic tissues. It may also function as an ecotropic retroviral leukemia receptor. |
Synonyms | ATRC1; CAT-1; ERR; HCAT1; REC1L |
Note | Immunogen sequence homology: Horse: 100%; Human: 100%; Bovine: 93%; Pig: 92%; Rat: 92%; Mouse: 92%; Guinea pig: 92%; Dog: 86%; Rabbit: 79% |
Reference Data | |
Protein Families | Druggable Genome, Transmembrane |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
Be the first one to submit a review