TULP1 Rabbit Polyclonal Antibody

CAT#: TA334014

Rabbit Polyclonal Anti-TULP1 Antibody


USD 539.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (2)
Transient overexpression lysate of tubby like protein 1 (TULP1)
    • 100 ug

USD 665.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00

Other products for "TULP1"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-TULP1 Antibody: synthetic peptide directed towards the middle region of human TULP1. Synthetic peptide located within the following region: EEEEAATVIKKSNQKGKAKGKGKKKAKEERAPSPPVEVDEPREFVLRPAP
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 60 kDa
Gene Name tubby like protein 1
Background TULP1 is required for normal development of photoreceptor synapses. TULP1 is also required for normal photoreceptor function and for long-term survival of photoreceptor cells. TULP1 interacts with cytoskeleton proteins and may play a role in protein transport in photoreceptor cells. TULP1 binds lipids, especially phosphatidylinositol-3-phosphate, phosphatidylinositol-4-phosphate, phosphatidylinositol-5-phosphate, phosphatidylinositol-3,4-bisphosphate, phosphatidylinositol-4,5-bisphosphate, phosphatidylinositol-3,4,5-bisphosphate, phosphatidylserine and phosphatidic acid (in vitro).This gene encodes a member of the tubby-like gene family (TULPs). Members of this family have been identified in plants, vertebrates, and invertebrates and encode proteins of unknown function. TULP proteins share a conserved C-terminal region of approximately 200 amino acid residues. Mutations in this gene may be associated with retinitis pigmentosa. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Synonyms LCA15; RP14; TUBL1
Note Immunogen sequence homology: Dog: 100%; Horse: 100%; Human: 100%; Yeast: 100%; Bovine: 100%; Rabbit: 100%; Pig: 91%; Rat: 91%; Guinea pig: 91%; Mouse: 85%
Reference Data
Protein Families Druggable Genome

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.