ZFX Rabbit Polyclonal Antibody

SKU TA334007

Rabbit Polyclonal Anti-ZFX Antibody

Product Data

• Application: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-ZFX Antibody: synthetic peptide directed towards the middle region of human ZFX. Synthetic peptide located within the following region: KVYIFKADPGEDDLGGTVDIVESEPENDHGVELLDQNSSIRVPREKMVYM
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 90 kDa
• Gene Name: zinc finger protein, X-linked
• Database Link:
  NP_003401
  P17010
• Background: ZFX is a probable transcriptional activator.
• Synonyms: ZNF926
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Transcription Factors