SLC13A2 Rabbit Polyclonal Antibody

CAT#: TA333984

Rabbit Polyclonal Anti-SLC13A2 Antibody

Product Images

WB Suggested Anti-SLC13A2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:1562500; Positive Control: 721_B cell lysate

• 

  Small intestine

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-SLC13A2 Antibody: synthetic peptide directed towards the middle region of human SLC13A2. Synthetic peptide located within the following region: PNAKGESMVSDGTVAIFIGIIMFIIPSKFPGLTQDPENPGKLKAPLGLLD
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 64 kDa
• Gene Name: solute carrier family 13 member 2
• Database Link:
  NP_003975
  Entrez Gene 9058 Human
  UniProt ID Q13183
• Background: SLC13A2 belongs to the SLC13A transporter (TC 2.A.47) family, NADC subfamily. It is a multi-pass membrane protein. SLC13A2 cotransports of sodium ions and dicarboxylates such as succinate and citrate.
• Synonyms: NaCT; NaDC-1; NADC1; SDCT1
• Note: Immunogen sequence homology: Human: 100%; Rat: 93%; Rabbit: 85%; Pig: 79%; Bovine: 79%; Dog: 77%; Guinea pig: 75%

Reference Data

• Protein Families: Transmembrane