SLC13A2 Rabbit Polyclonal Antibody
Frequently bought together (2)
Transient overexpression lysate of solute carrier family 13 (sodium-dependent dicarboxylate transporter), member 2 (SLC13A2), transcript variant 2
USD 665.00
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
USD 200.00
Other products for "SLC13A2"
Specifications
Product Data | |
Applications | IHC, WB |
Recommended Dilution | WB, IHC |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-SLC13A2 Antibody: synthetic peptide directed towards the middle region of human SLC13A2. Synthetic peptide located within the following region: PNAKGESMVSDGTVAIFIGIIMFIIPSKFPGLTQDPENPGKLKAPLGLLD |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 64 kDa |
Gene Name | solute carrier family 13 member 2 |
Database Link | |
Background | SLC13A2 belongs to the SLC13A transporter (TC 2.A.47) family, NADC subfamily. It is a multi-pass membrane protein. SLC13A2 cotransports of sodium ions and dicarboxylates such as succinate and citrate. |
Synonyms | NaCT; NaDC-1; NADC1; SDCT1 |
Note | Immunogen sequence homology: Human: 100%; Rat: 93%; Rabbit: 85%; Pig: 79%; Bovine: 79%; Dog: 77%; Guinea pig: 75% |
Reference Data | |
Protein Families | Transmembrane |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.