MCT7 (SLC16A6) Rabbit Polyclonal Antibody
Product Data | |
Application | WB |
---|---|
Recommended Dilution | WB |
Reactivity | Human |
Antibody Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-SLC16A6 Antibody: synthetic peptide directed towards the middle region of human SLC16A6. Synthetic peptide located within the following region: ILKEKSFICYALFGLFATLGFFAPSLYIIPLGISLGIDQDRAAFLLSTMA |
Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Shipping | Blue Ice |
Predicted Protein Size | 57 kDa |
Gene Name | solute carrier family 16 member 6 |
Database Link | |
Background | SLC16A6 is a proton-linked monocarboxylate transporter.It catalyzes the rapid transport across the plasma membrane of many monocarboxylates such as lactate, pyruvate, branched-chain oxo acids derived from leucine, valine and isoleucine, and the ketone bodies acetoacetate, beta-hydroxybutyrate and acetate. |
Synonyms | MCT6; MCT7 |
Note | Immunogen sequence homology: Horse: 100%; Human: 100%; Rabbit: 100%; Pig: 93%; Rat: 93%; Mouse: 93%; Guinea pig: 93%; Dog: 86%; Bovine: 79% |
Reference Data | |
Protein Families | Transmembrane |
Write Your Own Review
Product Manuals |
FAQs |
SDS |
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.