HNRPUL1 (HNRNPUL1) Rabbit Polyclonal Antibody

SKU
TA333898
Rabbit Polyclonal Anti-HNRNPUL1 Antibody
$585.00
5 Days*
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-HNRNPUL1 Antibody is: synthetic peptide directed towards the N-terminal region of Human HNRNPUL1. Synthetic peptide located within the following region: MGFCHVGQAGLELLTSGDPPASASQSAGITGVSHRARPSVFVFLIHYSSF
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 42 kDa
Gene Name heterogeneous nuclear ribonucleoprotein U like 1
Database Link
Background This gene encodes a nuclear RNA-binding protein of the heterogeneous nuclear ribonucleoprotein (hnRNP) family. This protein binds specifically to adenovirus E1B-55kDa oncoprotein. It may play an important role in nucleocytoplasmic RNA transport, and its function is modulated by E1B-55kDa in adenovirus-infected cells. Two transcript variants encoding different isoforms have been found for this gene. Additional variants have also been found, but their full-length natures have not been determined.
Synonyms E1B-AP5; E1BAP5; HNRPUL1
Note Immunogen sequence homology: Human: 100%; Rat: 86%; Mouse: 85%
Reference Data
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:HNRPUL1 (HNRNPUL1) Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.