ZNF236 Rabbit Polyclonal Antibody

CAT#: TA333892

Rabbit Polyclonal Anti-ZNF236 Antibody

Product Images

WB Suggested Anti-ZNF236 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:1562500; Positive Control: HepG2 cell lysateZNF236 is supported by BioGPS gene expression data to be expressed in HepG2

• 

  Rabbit Anti-ZNF236 Antibody; Formalin Fixed Paraffin Embedded Tissue: Human Adult Liver; Observed Staining: Nuclear in hepatocytes, moderate signal, moderate tissue distribution; Primary Antibody Concentration: 1:100; Secondary Antibody: Donkey anti-Rabb

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-ZNF236 Antibody: synthetic peptide directed towards the middle region of human ZNF236. Synthetic peptide located within the following region: VSATGETEGGDICMEEEEEHSDRNASRKSRPEVITFTEEETAQLAKIRPQ
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 204 kDa
• Gene Name: zinc finger protein 236
• Database Link:
  NP_031371
  Entrez Gene 7776 Human
  UniProt ID Q9UL36
• Background: ZNF236 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 30 C2H2-type zinc fingers. ZNF236 may be involved in transcriptional regulation.
• Synonyms: ZNF236A; ZNF236B
• Note: Immunogen sequence homology: Pig: 100%; Rat: 100%; Human: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%