WHSC1 Rabbit Polyclonal Antibody

SKU TA333862

Rabbit Polyclonal Anti-WHSC1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-WHSC1 Antibody: synthetic peptide directed towards the N terminal of human WHSC1. Synthetic peptide located within the following region: KYNVGDLVWSKVSGYPWWPCMVSADPLLHSYTKLKGQKKSARQYHVQFFG
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 88 kDa
• Gene Name: Wolf-Hirschhorn syndrome candidate 1
• Database Link:
  NP_055734
  O96028
• Background: WHSC1 encodes a protein that contains four domains present in other developmental proteins: a PWWP domain, an HMG box, a SET domain, and a PHD-type zinc finger. It is expressed ubiquitously in early development. Wolf-Hirschhorn syndrome (WHS) is a malformation syndrome associated with a hemizygous deletion of the distal short arm of chromosome 4.
• Synonyms: FLJ23286; KIAA1090; MMSET; NSD2; REIIBP; TRX5
• Note: Immunogen sequence homology: Horse: 100%; Human: 100%; Dog: 93%; Pig: 88%; Guinea pig: 88%; Rat: 86%; Mouse: 86%; Rabbit: 76%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors
• Protein Pathways: Lysine degradation