ANKLE2 Rabbit Polyclonal Antibody

SKU TA333847

Rabbit Polyclonal Anti-ANKLE2 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-ANKLE2 Antibody: synthetic peptide directed towards the middle region of human ANKLE2. Synthetic peptide located within the following region: CYSPSDRQSWPSPAVKGRFKSQLPDLSGPHSYSPGRNSVAGSNPAKPGLG
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 104 kDa
• Gene Name: ankyrin repeat and LEM domain containing 2
• Database Link:
  NP_055929
  Q86XL3
• Background: ANKLE2 is a single-pass membrane protein. It contains 1 ANK repeat and 1 LEM domain. It contains 1 RING-type zinc finger. The function of ANKLE2 remains unknown.
• Synonyms: KIAA0692; Lem4; LEMD7; MCPH16
• Note: Immunogen sequence homology: Human: 100%

Reference Data

• Protein Families: Transmembrane