ZCCHC14 Rabbit Polyclonal Antibody

CAT#: TA333842

Rabbit Polyclonal Anti-ZCCHC14 Antibody

Product Images

WB Suggested Anti-ZCCHC14 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: MCF7 cell lysateThere is BioGPS gene expression data showing that ZCCHC14 is expressed in MCF7

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-ZCCHC14 Antibody: synthetic peptide directed towards the N terminal of human ZCCHC14. Synthetic peptide located within the following region: RYLASLPSHVLKNDHVRRFLSTSSPPQQLQSPSPGNPSLSKVGTVMGVSG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 100 kDa
• Gene Name: zinc finger CCHC-type containing 14
• Database Link:
  NP_055959
  Entrez Gene 23174 Human
  UniProt ID Q8WYQ9
• Background: ZCCHC14 contains 1 CCHC-type zinc finger. The function of ZCCHC14 remains unknown.
• Synonyms: BDG-29; BDG29
• Note: Immunogen sequence homology: Human: 100%; Rat: 93%; Mouse: 93%; Bovine: 93%; Pig: 92%; Horse: 92%; Guinea pig: 92%; Dog: 86%; Rabbit: 79%