ZCCHC14 Rabbit Polyclonal Antibody

SKU TA333842

Rabbit Polyclonal Anti-ZCCHC14 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-ZCCHC14 Antibody: synthetic peptide directed towards the N terminal of human ZCCHC14. Synthetic peptide located within the following region: RYLASLPSHVLKNDHVRRFLSTSSPPQQLQSPSPGNPSLSKVGTVMGVSG
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 100 kDa
• Gene Name: zinc finger CCHC-type containing 14
• Database Link:
  NP_055959
  Q8WYQ9
• Background: ZCCHC14 contains 1 CCHC-type zinc finger. The function of ZCCHC14 remains unknown.
• Synonyms: BDG-29; BDG29
• Note: Immunogen sequence homology: Human: 100%; Rat: 93%; Mouse: 93%; Bovine: 93%; Pig: 92%; Horse: 92%; Guinea pig: 92%; Dog: 86%; Rabbit: 79%

Reference Data