SGEF (ARHGEF26) Rabbit Polyclonal Antibody

SKU TA333805

Rabbit Polyclonal Anti-ARHGEF26 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-ARHGEF26 Antibody: synthetic peptide directed towards the N terminal of human SGEF. Synthetic peptide located within the following region: MDGESEVDFSSNSITPLWRRRSIPQPHQVLGRSKPRPQSYQSPNGLLITD
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 97 kDa
• Gene Name: Rho guanine nucleotide exchange factor 26
• Database Link:
  NP_056410
  Q96DR7
• Background: SGEF activates RhoG GTPase by promoting the exchange of GDP by GTP. SGEF is required for the formation of membrane ruffles during macropinocytosis. SGEF is also required for the formation of cup-like structures during trans-endothelial migration of leukocyte.
• Synonyms: CSGEF; HMFN1864; SGEF
• Note: Immunogen sequence homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Yeast: 90%

Reference Data