TRPC4AP Rabbit Polyclonal Antibody

SKU TA333799

Rabbit Polyclonal Anti-TRPC4AP Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-TRPC4AP Antibody: synthetic peptide directed towards the middle region of human TRPC4AP. Synthetic peptide located within the following region: GASEENGLPHTSARTQLPQSMKIMHEIMYKLEVLYVLCVLLMGRQRNQVH
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 91 kDa
• Gene Name: transient receptor potential cation channel subfamily C member 4 associated protein
• Database Link:
  NP_056453
  Q8TEL6
• Background: TRPC4AP may participate in the activation of NFKB1 in response to ligation of TNFRSF1A. TRPC4AP could serve as a scaffolding protein to link TNFRSF1A to the IKK signalosome.
• Synonyms: C20orf188; PPP1R158; TRRP4AP; TRUSS
• Note: Immunogen sequence homology: Pig: 100%; Human: 100%; Guinea pig: 100%; Dog: 93%; Rat: 93%; Horse: 93%; Mouse: 86%; Rabbit: 86%

Reference Data

• Protein Families: Druggable Genome