SLC25A37 Rabbit Polyclonal Antibody

SKU TA333775

Rabbit Polyclonal Anti-SLC25A37 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-SLC25A37 Antibody: synthetic peptide directed towards the middle region of human SLC25A37. Synthetic peptide located within the following region: RTVYQLNGLAGYFKGIQARVIYQMPSTAISWSVYEFFKYFLTKRQLENRA
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 37 kDa
• Gene Name: solute carrier family 25 member 37
• Database Link:
  NP_057696
  Q9NYZ2
• Background: SLC25A37 belongs to the SLC25 family of mitochondrial carrier proteins (Haitina et al., 2006 [PubMed 16949250]).
• Synonyms: HT015; MFRN; MFRN1; MSC; MSCP; PRO1278; PRO1584; PRO2217
• Note: Immunogen sequence homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Guinea pig: 100%; Dog: 93%; Rabbit: 93%; Bovine: 86%; Horse: 83%

Reference Data