glycerol 3 phosphate permease (SLC37A1) Rabbit Polyclonal Antibody

SKU TA333747

Rabbit Polyclonal Anti-SLC37A1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-SLC37A1 Antibody: synthetic peptide directed towards the middle region of human SLC37A1. Synthetic peptide located within the following region: LKIPGVIEFSLCLLFAKLVSYTFLFWLPLYITNVDHLDAKKAGELSTLFD
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 58 kDa
• Gene Name: solute carrier family 37 member 1
• Database Link:
  NP_061837
  P57057
• Background: SLC37A1, a member of the sugar-phosphate transport family, transports glycerol-3-phosphate (G3P) between cellular compartments for its utilization in several compartment-specific biochemical pathways.SLC37A1, a member of the sugar-phosphate transport family, transports glycerol-3-phosphate (G3P) between cellular compartments for its utilization in several compartment-specific biochemical pathways. [supplied by OMIM]
• Synonyms: G3PP
• Note: Immunogen sequence homology: Rat: 100%; Human: 100%; Pig: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Dog: 86%; Rabbit: 86%; Zebrafish: 79%; Guinea pig: 79%

Reference Data

• Protein Families: Transmembrane