YIF1A Rabbit Polyclonal Antibody

SKU TA333737

Rabbit Polyclonal Anti-YIF1A Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-YIF1A Antibody is: synthetic peptide directed towards the N-terminal region of Human YIF1A. Synthetic peptide located within the following region: LFDDTSGGYSSQPGGYPATGADVAFSVNHLLGDPMANVAMAYGSSIASHG
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 32 kDa
• Gene Name: Yip1 interacting factor homolog A, membrane trafficking protein
• Database Link:
  NP_065203
  O95070
• Background: YIF1A has a possible role in transport between endoplasmic reticulum and Golgi.
• Synonyms: 54TM; FinGER7; YIF1; YIF1P
• Note: Immunogen sequence homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Guinea pig: 100%; Dog: 93%; Mouse: 93%

Reference Data

• Protein Families: Transmembrane