ZnT1 (SLC30A1) Rabbit Polyclonal Antibody

SKU TA333727

Rabbit Polyclonal Anti-SLC30A1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-SLC30A1 Antibody: synthetic peptide directed towards the middle region of human SLC30A1. Synthetic peptide located within the following region: FCVNPCFPDPCKAFVEIINSTHASVYEAGPCWVLYLDPTLCVVMVCILLY
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 55 kDa
• Gene Name: solute carrier family 30 member 1
• Database Link:
  NP_067017
  Q9Y6M5
• Background: SLC30A1 may be involved in zinc transport out of the cell.
• Synonyms: ZNT1; ZRC1
• Note: Immunogen sequence homology: Human: 100%; Dog: 86%; Pig: 86%; Rat: 86%; Horse: 86%; Rabbit: 86%

Reference Data

• Protein Families: Transmembrane