SLC25A19 Rabbit Polyclonal Antibody

SKU TA333721

Rabbit Polyclonal Anti-SLC25A19 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-SLC25A19 Antibody: synthetic peptide directed towards the middle region of human SLC25A19. Synthetic peptide located within the following region: VHRGSVYDAREFSVHFVCGGLAACMATLTVHPVDVLRTRFAAQGEPKVYN
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 35 kDa
• Gene Name: solute carrier family 25 member 19
• Database Link:
  NP_068380
  Q9HC21
• Background: This gene encodes a mitochondrial protein that is a member of the solute carrier family. Although this protein was initially thought to be the mitochondrial deoxynucleotide carrier involved in the uptake of deoxynucleotides into the matrix of the mitochondria, further studies have demonstrated that this protein instead functions as the mitochondrial thiamine pyrophosphate carrier, which transports thiamine pyrophosphates into mitochondria. Mutations in this gene cause microcephaly, Amish type, a metabolic disease that results in severe congenital microcephaly, severe 2-ketoglutaric aciduria, and death within the first year. Multiple alternatively spliced variants, encoding the same protein, have been identified for this gene.
• Synonyms: DNC; MCPHA; MUP1; THMD3; THMD4; TPC
• Note: Immunogen sequence homology: Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Sheep: 93%; Bovine: 93%; Guinea pig: 93%; Yeast: 77%

Reference Data

• Protein Families: Druggable Genome