SLC5A7 Rabbit Polyclonal Antibody

SKU TA333720

Rabbit Polyclonal Anti-SLC5A7 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-SLC5A7 Antibody is: synthetic peptide directed towards the C-terminal region of Human SLC5A7. Synthetic peptide located within the following region: ILVKNENIKLDELALVKPRQSMTLSSTFTNKEAFLDVDSSPEGSGTEDNL
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 52 kDa
• Gene Name: solute carrier family 5 member 7
• Database Link:
  NP_068587
  Q9GZV3
• Background: The function of this protein remains unknown.
• Synonyms: CHT; CHT1; hCHT; HMN7A
• Note: Immunogen sequence homology: Dog: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Horse: 93%; Pig: 86%; Bovine: 86%; Guinea pig: 86%

Reference Data

• Protein Families: Transmembrane