FOXL2 Rabbit Polyclonal Antibody

SKU TA333692

Rabbit Polyclonal Anti-FOXL2 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-FOXL2 Antibody: synthetic peptide directed towards the N terminal of human FOXL2. Synthetic peptide located within the following region: MMASYPEPEDAAGALLAPETGRTVKEPEGPPPSPGKGGGGGGGTAPEKPD
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 39 kDa
• Gene Name: forkhead box L2
• Database Link:
  NP_075555
  P58012
• Background: FOXL2 is a member of the forkhead family. The forkhead domain is a monomeric DNA binding motif that defines a rapidly growing family of eukaryotic transcriptional regulators. Genetic and biochemical data suggest a central role in embryonic development for forkhead proteins.
• Synonyms: BPES; BPES1; PFRK; PINTO; POF3
• Note: Immunogen sequence homology: Dog: 100%; Human: 100%; Pig: 100%; Goat: 92%; Rabbit: 92%; Bovine: 84%; Mouse: 84%; Rat: 84%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors