Arylsulfatase J (ARSJ) Rabbit Polyclonal Antibody

SKU TA333678

Rabbit Polyclonal Anti-ARSJ Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-ARSJ Antibody is: synthetic peptide directed towards the C-terminal region of Human ARSJ. Synthetic peptide located within the following region: VWGPWYKEETKKKKPSKNQAEKKQKKSKKKKKKQQKAVSGSTCHSGVTCG
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 57 kDa
• Gene Name: arylsulfatase family member J
• Database Link:
  NP_078866
  Q5FYB0
• Background: Sulfatases, such as ARSJ, hydrolyze sulfate esters from sulfated steroids, carbohydrates, proteoglycans, and glycolipids. They are involved in hormone biosynthesis, modulation of cell signaling, and degradation of macromolecules.
• Synonyms: FLJ23548
• Note: Immunogen sequence homology: Human: 100%; Dog: 93%; Horse: 86%; Bovine: 85%

Reference Data

• Protein Families: Druggable Genome, Secreted Protein