SNIP1 Rabbit Polyclonal Antibody

SKU TA333669

Rabbit Polyclonal Anti-SNIP1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-SNIP1 Antibody: synthetic peptide directed towards the middle region of human SNIP1. Synthetic peptide located within the following region: RNDVGGGGSESQELVPRPGGNNKEKEVPAKEKPSFELSGALLEDTNTFRG
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 46 kDa
• Gene Name: Smad nuclear interacting protein 1
• Database Link:
  NP_078976
  Q8TAD8
• Background: Smad-binding peptide aptamers can be developed to selectively inhibit TGF-beta-induced gene expression.
• Synonyms: PMRED
• Note: Immunogen sequence homology: Pig: 100%; Human: 100%; Dog: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Bovine: 92%; Guinea pig: 92%; Zebrafish: 82%; Rabbit: 81%

Reference Data