COA8 Rabbit Polyclonal Antibody

SKU
TA333613
Rabbit Polyclonal Anti-APOPT1 Antibody
$585.00
5 Days*
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-APOPT1 Antibody is: synthetic peptide directed towards the C-terminal region of Human APOPT1. Synthetic peptide located within the following region: KEFLSKNFQKHMYYNRDWYKRNFAITFFMGKVALERIWNKLKQKQKKRSN
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 20 kDa
Gene Name apoptogenic 1, mitochondrial
Database Link
Background APOPT1 plays a role in the regulation of apoptosis. It mediates mitochondria-induced cell death in vascular smooth muscle cells through the release of cytochrome c from mitochondria, followed by the activation of the caspase cascade.
Synonyms APOP; APOP1; C14orf153
Note Immunogen sequence homology: Human: 100%; Horse: 82%; Bovine: 82%
Reference Data
Protein Families Secreted Protein
Write Your Own Review
You're reviewing:COA8 Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.