SLC7A3 Rabbit Polyclonal Antibody

CAT#: TA333604

Reviews ()
Write a review

Rabbit Polyclonal Anti-Slc7a3 Antibody



Get 29% off any Over-Expression Cell Lysate, a validated WB control, with any Ab purchase. Use code “OEL29“. View details.

USD 360.00


Availability*
5 Days

Size
    • 100 ul


Product images

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivity Mouse
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-Slc7a3 Antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: RAWSSAFDNLIGNHISRTLKGTILLKMPHVLAEYPDFFALALVLLLTGLL
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 67 kDa
Gene Name solute carrier family 7 member 3
Background Slc7a3 mediates the uptake of the cationic amino acids arginine, lysine and ornithine in a sodium-independent manner.
Synonyms ATRC3; CAT-3; CAT3
Note Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%
Reference Data
Protein Families Druggable Genome, Transmembrane
Other products for "SLC7A3"
Frequently bought together (2)
Transient overexpression lysate of solute carrier family 7 (cationic amino acid transporter, y+ system), member 3 (SLC7A3), transcript variant 1
    • 100 ug

USD 360.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 169.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Antibody Performance Guarantee banner
ANTIBODY VALIDATION 101
Clone ID reveals the Source of Monoclonal Antibodies