AGAP8 (AGAP4) Rabbit Polyclonal Antibody

SKU TA333550

Rabbit Polyclonal Anti-AGAP4 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-AGAP4 Antibody is: synthetic peptide directed towards the C-terminal region of Human AGAP4. Synthetic peptide located within the following region: WPVELRKVMSSIGNDLANSIWEGSSQGQTKPSEKSTREEKERWIRSKYEE
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 73 kDa
• Gene Name: ArfGAP with GTPase domain, ankyrin repeat and PH domain 4
• Database Link:
  NP_597703
  Q96P64
• Background: AGAP4 is a putative GTPase-activating protein.
• Synonyms: AGAP-4; AGAP-8; AGAP8; CTGLF1; CTGLF5; MRIP2
• Note: Immunogen sequence homology: Human: 100%; Dog: 86%; Pig: 86%; Rat: 86%; Horse: 86%; Mouse: 86%; Bovine: 86%; Guinea pig: 86%; Rabbit: 85%

Reference Data