ZNF18 Rabbit Polyclonal Antibody

SKU TA333510

Rabbit Polyclonal Anti-ZNF18 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-ZNF18 Antibody: synthetic peptide directed towards the N terminal of human ZNF18. Synthetic peptide located within the following region: DLGQALGLLPSLAKAEDSQFSESDAALQEELSSPETARQLFRQFRYQVMS
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 62 kDa
• Gene Name: zinc finger protein 18
• Database Link:
  NP_653281
  P17022
• Background: ZNF18 is a candidate transcription factor
• Synonyms: HDSG1; KOX11; Zfp535; ZKSCAN6; ZNF535; ZSCAN38
• Note: Immunogen sequence homology: Pig: 100%; Rat: 100%; Human: 100%; Guinea pig: 100%; Dog: 92%; Bovine: 92%; Rabbit: 92%; Mouse: 83%

Reference Data

• Protein Families: Transcription Factors