B4GALNT2 Rabbit Polyclonal Antibody

CAT#: TA333466

Rabbit Polyclonal Anti-B4GALNT2 Antibody

Product Images

Host: Rabbit; Target Name: B4GALNT2; Sample Tissue: Jurkat Whole Cell lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-B4GALNT2 Antibody is: synthetic peptide directed towards the N-terminal region of Human B4GALNT2. Synthetic peptide located within the following region: FSYDGIWLFPKNQCKCEANKEQGGYNFQDAYGQSDLPAVKARRQAEFEHF
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 62 kDa
• Gene Name: beta-1,4-N-acetyl-galactosaminyltransferase 2
• Database Link:
  NP_703147
  Entrez Gene 124872 Human
  UniProt ID Q8NHY0
• Background: B4GALNT2 catalyzes the last step in the biosynthesis of the human Sd(a) antigen through the addition of an N-acetylgalactosamine residue via a beta-1,4 linkage to a subterminal galactose residue substituted with an alpha-2,3-linked sialic acid. B4GALNT2 also catalyzes the last step in the biosynthesis of the Cad antigen.
• Synonyms: B4GALT; GALGT2
• Note: Immunogen sequence homology: Human: 100%

Reference Data

• Protein Families: Transmembrane