ZADH2 Rabbit Polyclonal Antibody

CAT#: TA333444

Reviews ()
Write a review

Rabbit Polyclonal Anti-ZADH2 Antibody



USD 396.00


Availability*
5 Days

Size
    • 100 ul


Product images

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivity Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-ZADH2 Antibody: synthetic peptide directed towards the N terminal of human ZADH2. Synthetic peptide located within the following region: MLRLVPTGARAIVDMSYARHFLDFQGSAIPQAMQKLVVTRLSPNFREAVT
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 40 kDa
Gene Name zinc binding alcohol dehydrogenase domain containing 2
Background The exact functions of ZADH2 remain unknown.
Synonyms MGC45594
Note Immunogen sequence homology: Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Dog: 93%
Reference Data
Protein Families Druggable Genome
Other products for "ZADH2"
Frequently bought together (3)
Recombinant protein of human zinc binding alcohol dehydrogenase domain containing 2 (ZADH2)
    • 20 ug

USD 823.00


Transient overexpression lysate of zinc binding alcohol dehydrogenase domain containing 2 (ZADH2)
    • 100 ug

USD 396.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 186.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Antibody Performance Guarantee banner
ANTIBODY VALIDATION 101
Clone ID reveals the Source of Monoclonal Antibodies