ZADH2 Rabbit Polyclonal Antibody

SKU TA333444

Rabbit Polyclonal Anti-ZADH2 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-ZADH2 Antibody: synthetic peptide directed towards the N terminal of human ZADH2. Synthetic peptide located within the following region: MLRLVPTGARAIVDMSYARHFLDFQGSAIPQAMQKLVVTRLSPNFREAVT
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 40 kDa
• Gene Name: zinc binding alcohol dehydrogenase domain containing 2
• Database Link:
  NP_787103
  Q8N4Q0
• Background: The exact functions of ZADH2 remain unknown.
• Synonyms: MGC45594
• Note: Immunogen sequence homology: Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Dog: 93%

Reference Data

• Protein Families: Druggable Genome