ZDHHC21 Rabbit Polyclonal Antibody

CAT#: TA333424

Reviews ()
Write a review

Rabbit Polyclonal Anti-ZDHHC21 Antibody


 Product Datasheet for 'TA333424'

USD 360.00


Availability*
5 Days

Size
    • 100 ul


Product images

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-ZDHHC21 Antibody: synthetic peptide directed towards the middle region of human ZDHHC21. Synthetic peptide located within the following region: ELLTCYALMFSFCHYYYFLPLKKRNLDLFVFRHELAIMRLAAFMGITMLV
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Predicted Protein Size 31 kDa
Gene Name zinc finger DHHC-type containing 21
Background The function of this protein remains unknown.
Synonyms 9130404H11Rik; DHHC-21; DHHC21; DNZ1; HSPC097
Note Immunogen sequence homology: Human: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 93%
Reference Data
Protein Families Transmembrane
Other products for "ZDHHC21"
Frequently bought together (2)
Transient overexpression lysate of zinc finger, DHHC-type containing 21 (ZDHHC21)
    • 100 ug

USD 315.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 150.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Antibody Performance Guarantee banner
ANTIBODY VALIDATION 101
68 Mouse Clones