SLC6A15 Rabbit Polyclonal Antibody
Frequently bought together (2)
Transient overexpression lysate of solute carrier family 6 (neutral amino acid transporter), member 15 (SLC6A15), transcript variant 1
USD 436.00
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
USD 200.00
Other products for "SLC6A15"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-SLC6A15 Antibody: synthetic peptide directed towards the N terminal of human SLC6A15. Synthetic peptide located within the following region: DQCPLVKNASHTFVEPECEQSSATTYYWYREALNISSSISESGGLNWKMT |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 82 kDa |
Gene Name | solute carrier family 6 member 15 |
Database Link | |
Background | SLC6A15 shows structural characteristics of an Na(+) and Cl(-)-dependent neurotransmitter transporter, including 12 transmembrane (TM) domains, intracellular N and C termini, and large extracellular loops containing multiple N-glycosylation sites.SLC6A15 shows structural characteristics of an Na(+) and Cl(-)-dependent neurotransmitter transporter, including 12 transmembrane (TM) domains, intracellular N and C termini, and large extracellular loops containing multiple N-glycosylation sites. |
Synonyms | hv7-3; NTT73; SBAT1; V7-3 |
Note | Immunogen sequence homology: Dog: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Mouse: 93%; Pig: 86%; Rat: 86%; Guinea pig: 86% |
Reference Data | |
Protein Families | Druggable Genome, Transmembrane |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.