IDNK Rabbit Polyclonal Antibody

SKU
TA332351
Rabbit Polyclonal Anti-IDNK Antibody
$585.00
5 Days*
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-IDNK Antibody is: synthetic peptide directed towards the N-terminal region of Human IDNK. Synthetic peptide located within the following region: LLASELGWKFYDADDYHPEENRRKMGKGIPLNDQDRIPWLCNLHDILLRD
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 16 kDa
Gene Name idnK, gluconokinase homolog (E. coli)
Database Link
Background The function of this protein remains unknown.
Synonyms bA522I20.2; C9orf103; hGntK
Note Immunogen sequence homology: Human: 100%; Dog: 93%; Pig: 93%; Rat: 86%; Bovine: 86%; Rabbit: 86%; Guinea pig: 86%; Horse: 79%; Mouse: 79%
Reference Data
Write Your Own Review
You're reviewing:IDNK Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.