ZSCAN2 Rabbit Polyclonal Antibody

SKU TA332280

Rabbit Polyclonal Anti-ZSCAN2 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-ZSCAN2 Antibody: synthetic peptide directed towards the N terminal of human ZSCAN2. Synthetic peptide located within the following region: MMAADIPRVTTPLSSLVQVPQEEDRQEEEVTTMILEDDSWVQEAVLQEDG
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 67 kDa
• Gene Name: zinc finger and SCAN domain containing 2
• Database Link:
  NP_001007073
  Q7Z7L9
• Background: ZSCAN2 contains several copies of zinc finger motif, which is commonly found in transcriptional regulatory proteins. Studies in mice show that ZSCAN2 is expressed during embryonic development, and specifically in the testis in adult mice, suggesting that it may play a role in regulating genes in germ cells.The protein encoded by this gene contains several copies of zinc finger motif, which is commonly found in transcriptional regulatory proteins. Studies in mice show that this gene is expressed during embryonic development, and specifically in the testis in adult mice, suggesting that it may play a role in regulating genes in germ cells. Alternative splicing of this gene results in several transcript variants encoding different isoforms.
• Synonyms: ZFP29; ZNF854
• Note: Immunogen sequence homology: Human: 100%; Pig: 92%; Mouse: 92%; Dog: 83%; Rat: 83%

Reference Data

• Protein Families: Transcription Factors