C1orf69 (IBA57) Rabbit Polyclonal Antibody

SKU TA332270

Rabbit Polyclonal Anti-IBA57 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-IBA57 Antibody is: synthetic peptide directed towards the N-terminal region of Human IBA57. Synthetic peptide located within the following region: ILYGLQEHSEVSGFLLECDSSVQGALQKHLALYRIRRKVTVEPHPELRVW
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 39 kDa
• Gene Name: IBA57 homolog, iron-sulfur cluster assembly
• Database Link:
  NP_001010867
  Q5T440
• Background: IBA57 is required for normal heme biosynthesis.
• Synonyms: C1orf69; MMDS3; SPG74
• Note: Immunogen sequence homology: Human: 100%; Mouse: 93%; Dog: 79%; Pig: 79%; Rat: 79%; Bovine: 79%

Reference Data