DCAF12L2 Rabbit Polyclonal Antibody

SKU TA332259

Rabbit Polyclonal Anti-DCAF12L2 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-DCAF12L2 Antibody is: synthetic peptide directed towards the C-terminal region of Human DCAF12L2. Synthetic peptide located within the following region: LDPRQRQQNIRPLCSREGGTGVRSLSFYQHIITVGTGHGSLLFYDIRAQK
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 50 kDa
• Gene Name: DDB1 and CUL4 associated factor 12-like 2
• Database Link:
  NP_001013650
  Q5VW00
• Background: This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by Gly-His and Trp-Asp (GH-WD), which may facilitate formation of heterotrimeric or multi-protein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This gene appears to represent an intronless retrocopy of a related multi-exon gene located on chromosome 9. However, the CDS of this intronless gene remains intact, it is conserved in other mammalian species, it is known to be transcribed, and it is therefore thought to encode a functional protein.
• Synonyms: WDR40C
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Human: 100%; Rat: 93%; Mouse: 93%; Rabbit: 93%; Guinea pig: 86%

Reference Data