DCAF12L2 Rabbit Polyclonal Antibody

CAT#: TA332259

Rabbit Polyclonal Anti-DCAF12L2 Antibody


USD 539.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (2)
Transient overexpression lysate of DDB1 and CUL4 associated factor 12-like 2 (DCAF12L2)
    • 100 ug

USD 665.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00

Other products for "DCAF12L2"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-DCAF12L2 Antibody is: synthetic peptide directed towards the C-terminal region of Human DCAF12L2. Synthetic peptide located within the following region: LDPRQRQQNIRPLCSREGGTGVRSLSFYQHIITVGTGHGSLLFYDIRAQK
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 50 kDa
Gene Name DDB1 and CUL4 associated factor 12-like 2
Background This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by Gly-His and Trp-Asp (GH-WD), which may facilitate formation of heterotrimeric or multi-protein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This gene appears to represent an intronless retrocopy of a related multi-exon gene located on chromosome 9. However, the CDS of this intronless gene remains intact, it is conserved in other mammalian species, it is known to be transcribed, and it is therefore thought to encode a functional protein.
Synonyms WDR40C
Note Immunogen sequence homology: Dog: 100%; Pig: 100%; Human: 100%; Rat: 93%; Mouse: 93%; Rabbit: 93%; Guinea pig: 86%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.