ZBTB7C Rabbit Polyclonal Antibody

SKU TA332238

Rabbit Polyclonal Anti-ZBTB7C Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-ZBTB7C Antibody: synthetic peptide directed towards the N terminal of human ZBTB7C. Synthetic peptide located within the following region: MANDIDELIGIPFPNHSSEVLCSLNEQRHDGLLCDVLLVVQEQEYRTHRS
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 69 kDa
• Gene Name: zinc finger and BTB domain containing 7C
• Database Link:
  NP_001034449
  A1YPR0
• Background: The function of Anti-ZBTB7C has not yet been determined.
• Synonyms: APM-1; APM1; ZBTB36; ZNF857C
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 92%

Reference Data