KCTD1 Rabbit Polyclonal Antibody
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-KCTD1 Antibody is: synthetic peptide directed towards the C-terminal region of Human KCTD1. Synthetic peptide located within the following region: NHDSTHVIRFPLNGYCHLNSVQVLERLQQRGFEIVGSCGGGVDSSQFSEY |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 95 kDa |
Gene Name | potassium channel tetramerization domain containing 1 |
Database Link | |
Background | KCTD1 may repress the transcriptional activity of AP-2 family members, including TFAP2A, TFAP2B and TFAP2C to various extent. |
Synonyms | C18orf5; SENS |
Note | Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100% |
Reference Data | |
Protein Families | Ion Channels: Other |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Antibody Resources |
Other products for "KCTD1"
Frequently bought together (1)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
USD 169.00
Customer
Reviews
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.