FBXW12 Rabbit Polyclonal Antibody

SKU
TA332170
Rabbit Polyclonal Anti-FBXW12 Antibody
$585.00
5 Days*
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-FBXW12 Antibody is: synthetic peptide directed towards the C-terminal region of Human FBXW12. Synthetic peptide located within the following region: CASACWTPKVKNRITLMSQSSTGKKTEFITFDLTTKKTGGQTVIQAYEIA
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 48 kDa
Gene Name F-box and WD repeat domain containing 12
Database Link
Background Members of the F-box protein family, such as FBXW12, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1, cullin, and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains.
Synonyms FBW12; FBXO12; FBXO35
Note Immunogen sequence homology: Human: 100%
Reference Data
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:FBXW12 Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.