FBXW12 Rabbit Polyclonal Antibody

CAT#: TA332170

Rabbit Polyclonal Anti-FBXW12 Antibody

Product Images

Host: Rabbit; Target Name: FBXW12; Sample Tissue: Fetal Brain lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-FBXW12 Antibody is: synthetic peptide directed towards the C-terminal region of Human FBXW12. Synthetic peptide located within the following region: CASACWTPKVKNRITLMSQSSTGKKTEFITFDLTTKKTGGQTVIQAYEIA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 48 kDa
• Gene Name: F-box and WD repeat domain containing 12
• Database Link:
  NP_001153401
  Entrez Gene 285231 Human
  UniProt ID Q6X9E4
• Background: Members of the F-box protein family, such as FBXW12, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1, cullin, and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains.
• Synonyms: FBW12; FBXO12; FBXO35
• Note: Immunogen sequence homology: Human: 100%

Reference Data

• Protein Families: Druggable Genome