PET112L (GATB) Rabbit Polyclonal Antibody

SKU TA332093

Rabbit Polyclonal Anti-PET112 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-PET112 Antibody is: synthetic peptide directed towards the N-terminal region of Human PET112. Synthetic peptide located within the following region: GSTSNQIRGESSVAQQPLHTAQKTRKGEHKWAAVVGLEIHAQISSNSKLF
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 58 kDa
• Gene Name: glutamyl-tRNA(Gln) amidotransferase, subunit B
• Database Link:
  NP_004555
  O75879
• Background: PET112 allows the formation of correctly charged Gln-tRNA(Gln) through the transamidation of misacylated Glu-tRNA(Gln) in the mitochondria. The reaction takes place in the presence of glutamine and ATP through an activated gamma-phospho-Glu-tRNA(Gln).
• Synonyms: HSPC199; PET112; PET112L
• Note: Immunogen sequence homology: Human: 100%; Rat: 92%; Mouse: 92%; Rabbit: 91%

Reference Data