HS3ST1 Rabbit Polyclonal Antibody

CAT#: TA332073

Rabbit Polyclonal Anti-HS3ST1 Antibody

Product Images

WB Suggested Anti-HS3ST1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 12500; Positive Control: Human Stomach

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-HS3ST1 Antibody: synthetic peptide directed towards the middle region of human HS3ST1. Synthetic peptide located within the following region: TKGFYCLRDSGRDRCLHESKGRAHPQVDPKLLNKLHEYFHEPNKKFFELV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 34 kDa
• Gene Name: heparan sulfate-glucosamine 3-sulfotransferase 1
• Database Link:
  NP_005105
  Entrez Gene 9957 Human
  UniProt ID O14792
• Background: HS3ST1 is the rate limiting enzyme for synthesis of HSact. HS3ST1 performs the crucial step modification in the biosynthesis of anticoagulant heparan sulfate (HSact) that is to complete the structure of the antithrombin pentasaccharide binding site.Heparan sulfate biosynthetic enzymes are key components in generating a myriad of distinct heparan sulfate fine structures that carry out multiple biologic activities. The enzyme encoded by this gene is a member of the heparan sulfate biosynthetic enzyme family. It possesses both heparan sulfate glucosaminyl 3-O-sulfotransferase activity, anticoagulant heparan sulfate conversion activity, and is a rate limiting enzyme for synthesis of anticoagulant heparan. This enzyme is an intraluminal Golgi resident protein.
• Synonyms: 3OST; 3OST1
• Note: Immunogen sequence homology: Dog: 100%; Horse: 100%; Human: 100%; Pig: 92%; Rat: 92%; Mouse: 92%; Bovine: 92%; Rabbit: 92%; Guinea pig: 92%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Heparan sulfate biosynthesis