ABCA1 Rabbit Polyclonal Antibody

SKU TA332061

Rabbit Polyclonal Anti-Abca1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Mouse
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Abca1 Antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: NRRAFGDKQSCLHPFTEDDAVDPNDSDIDPESRETDLLSGMDGKGSYQLK
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 254 kDa
• Gene Name: ATP binding cassette subfamily A member 1
• Database Link:
  NP_005493
  O95477
• Background: Abca1 is a cAMP-dependent and sulfonylurea-sensitive anion transporter. Abca1 is a key gatekeeper influencing intracellular cholesterol transport.
• Synonyms: ABC-1; ABC1; CERP; HDLDT1; TGD
• Note: Immunogen sequence homology: Human: 100%; Pig: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 93%; Dog: 86%; Rat: 86%; Guinea pig: 86%

Reference Data

• Protein Families: Druggable Genome, Transmembrane
• Protein Pathways: ABC transporters