PNMA1 Rabbit Polyclonal Antibody

SKU TA332047

Rabbit Polyclonal Anti-PNMA1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-PNMA1 Antibody: synthetic peptide directed towards the middle region of human PNMA1. Synthetic peptide located within the following region: KSNNPAITTAECLKALEQVFGSVESSRDAQIKFLNTYQNPGEKLSAYVIR
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 40 kDa
• Gene Name: paraneoplastic Ma antigen 1
• Database Link:
  NP_006020
  Q8ND90
• Background: PNMA1 encodes a protein that is highly restricted to the brain and testis. Anti-PNMA1 reacts mainly with subnuclear elements (including the nucleoli) and to a lesser degree the cytoplasm.
• Synonyms: MA1
• Note: Immunogen sequence homology: Human: 100%; Dog: 86%; Pig: 86%; Rat: 86%; Horse: 86%; Mouse: 86%; Rabbit: 86%; Guinea pig: 86%; Bovine: 79%

Reference Data