SGT1 (ECD) Rabbit Polyclonal Antibody

CAT#: TA332006

Rabbit Polyclonal Anti-ECD Antibody

Product Images

WB Suggested Anti-ECD Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: Jurkat cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-ECD Antibody: synthetic peptide directed towards the N terminal of human ECD. Synthetic peptide located within the following region: PAHMFGVTKFGDNIEDEWFIVYVIKQITKEFPELVARIEDNDGEFLLIEA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 73 kDa
• Gene Name: ecdysoneless cell cycle regulator
• Database Link:
  NP_009196
  Entrez Gene 11319 Human
  UniProt ID O95905
• Background: The exact function of ECD remains unknown.
• Synonyms: GCR2; HSGT1; SGT1
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Goat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Rat: 93%; Mouse: 93%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors