RAB3GAP2 Rabbit Polyclonal Antibody

CAT#: TA331994

Rabbit Polyclonal Anti-RAB3GAP2 Antibody

Product Images

Host: Rabbit; Target Name: RAB3GAP2; Sample Tissue: Fetal Liver lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-RAB3GAP2 Antibody is: synthetic peptide directed towards the middle region of Human RAB3GAP2. Synthetic peptide located within the following region: SWLQDCVLSLSPTNDLMVIAREQKAVFLVPKWKYSDKGKEEMQFAVGWSG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 22 kDa
• Gene Name: RAB3 GTPase activating non-catalytic protein subunit 2
• Database Link:
  NP_036546
  Entrez Gene 25782 Human
  UniProt ID Q9H2M9
• Background: The protein encoded by this gene belongs to the RAB3 protein family, members of which are involved in regulated exocytosis of neurotransmitters and hormones. This protein forms the Rab3 GTPase-activating complex with RAB3GAP1, where it constitutes the regulatory subunit, whereas the latter functions as the catalytic subunit. This gene has the highest level of expression in the brain, consistent with it having a key role in neurodevelopment. Mutations in this gene are associated with Martsolf syndrome.
• Synonyms: p150; RAB3-GAP150; RAB3GAP150; SPG69; WARBM2
• Note: Immunogen sequence homology: Dog: 100%; Human: 100%; Rat: 93%; Bovine: 93%; Pig: 92%; Guinea pig: 92%; Mouse: 86%