PALD (PALD1) Rabbit Polyclonal Antibody

SKU TA331979

Rabbit Polyclonal Anti-PALD1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-PALD1 Antibody is: synthetic peptide directed towards the N-terminal region of Human PALD1. Synthetic peptide located within the following region: FRRVLQKLQKDGHRECVIFCVREEPVLFLRADEDFVSYTPRDKQNLHENL
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 94 kDa
• Gene Name: phosphatase domain containing, paladin 1
• Database Link:
  NP_055246
  Q9ULE6
• Background: The function of this protein remains unknown.
• Synonyms: KIAA1274; PALD
• Note: Immunogen sequence homology: Horse: 100%; Human: 100%; Bovine: 100%; Dog: 86%; Pig: 86%; Guinea pig: 86%; Rat: 79%

Reference Data