DTX4 Rabbit Polyclonal Antibody

SKU TA331963

Rabbit Polyclonal Anti-DTX4 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-DTX4 Antibody is: synthetic peptide directed towards the C-terminal region of Human DTX4. Synthetic peptide located within the following region: TVIWNEVHHKTEFGSNLTGHGYPDANYLDNVLAELAAQGISEDSTAQEKD
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 67 kDa
• Gene Name: deltex 4, E3 ubiquitin ligase
• Database Link:
  NP_055992
  Q9Y2E6
• Background: DTX4 is a regulator of Notch signaling, a signaling pathway involved in cell-cell communications that regulates a broad spectrum of cell-fate determinations. It functions as an ubiquitin ligase protein in vivo, mediating 'Lys48'-linked polyubiquitination and promoting degradation of TBK1, targeting to TBK1 requires interaction with NLRP4.
• Synonyms: RNF155
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Guinea pig: 100%; Rat: 93%; Bovine: 93%; Mouse: 86%; Rabbit: 86%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Notch signaling pathway