ZNF589 Rabbit Polyclonal Antibody

SKU
TA331930
Rabbit Polyclonal Anti-ZFP589 Antibody
$525.00
5 Days*
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-ZFP589 Antibody: synthetic peptide directed towards the middle region of human ZFP589. Synthetic peptide located within the following region: LEIQLSPAQNASSEEVDRISKRAETPGFGAVRFGECALAFNQKSNLFRQK
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 41 kDa
Gene Name zinc finger protein 589
Database Link
Background The function of Anti-ZFP589 has not yet been determined.
Synonyms SZF1
Note Immunogen sequence homology: Human: 100%
Reference Data
Protein Families Transcription Factors
Write Your Own Review
You're reviewing:ZNF589 Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.