PCYOX1 Rabbit Polyclonal Antibody

SKU TA331918

Rabbit Polyclonal Anti-PCYOX1 Antibody

Product Data

• Application: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-PCYOX1 Antibody: synthetic peptide directed towards the C terminal of human PCYOX1. Synthetic peptide located within the following region: IFSQETLTKAQILKLFLSYDYAVKKPWLAYPHYKPPEKCPSIILHDRLYY
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 57 kDa
• Gene Name: prenylcysteine oxidase 1
• Database Link:
  NP_057381
  Q9UHG3
• Background: Prenylated proteins contain one of two isoprenoid lipids, either the 15-carbon farnesyl or the 20-carbon geranylgeranyl, covalently attached to cysteine residues at or near their C terminus. PCYOX1 is capable of cleaving the thioether bond of prenylcysteines. The enzyme was isolated from bovine brain membranes and exhibits an apparent molecular mass of 63 kDa. This is a specific enzyme involved in prenylcysteine metabolism in mammalian cells, most likely comprising the final step in the degradation of prenylated proteins.
• Synonyms: PCL1
• Note: Immunogen sequence homology: Human: 100%; Rabbit: 100%; Dog: 86%; Horse: 86%; Pig: 83%; Bovine: 83%; Yeast: 75%

Reference Data