HSPA14 Rabbit Polyclonal Antibody
Product Data | |
Application | WB |
---|---|
Recommended Dilution | WB |
Reactivity | Human |
Antibody Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-HSPA14 Antibody is: synthetic peptide directed towards the N-terminal region of Human HSPA14. Synthetic peptide located within the following region: AVVAYSENEEIVGLAAKQSRIRNISNTVMKVKQILGRSSSDPQAQKYIAE |
Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Shipping | Blue Ice |
Predicted Protein Size | 56 kDa |
Gene Name | heat shock protein family A (Hsp70) member 14 |
Database Link | |
Background | HSPA14 is a component of the ribosome-associated complex (RAC), a complex involved in folding or maintaining nascent polypeptides in a folding-competent state. In the RAC complex, It binds to the nascent polypeptide chain, while DNAJC2 stimulates its ATPase activity. |
Synonyms | HSP70-4; HSP70L1 |
Note | Immunogen sequence homology: Human: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Mouse: 93%; Rat: 86%; Rabbit: 86%; Guinea pig: 86%; Bovine: 79% |
Reference Data | |
Protein Families | Druggable Genome, Stem cell - Pluripotency |
Write Your Own Review
Product Manuals |
FAQs |
SDS |
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.