C9orf167 (TOR4A) Rabbit Polyclonal Antibody

SKU TA331887

Rabbit Polyclonal Anti-TOR4A Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-TOR4A Antibody is: synthetic peptide directed towards the C-terminal region of Human TOR4A. Synthetic peptide located within the following region: QYHARHHCPEARAAQDCREELARRVADVVARAEAEEKTPLLVLDDVELMP
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 47 kDa
• Gene Name: torsin family 4 member A
• Database Link:
  NP_060193
  Q9NXH8
• Background: The function of this protein remains unknown.
• Synonyms: C9orf167
• Note: Immunogen sequence homology: Pig: 100%; Human: 100%; Dog: 92%; Horse: 92%; Rat: 86%; Bovine: 83%; Guinea pig: 79%

Reference Data